PDB entry 2jb7

View 2jb7 on RCSB PDB site
Description: pae2307 with amp
Class: unknown function
Keywords: hypothetical protein, unknown function
Deposited on 2006-12-04, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.172
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jb7a_
  • Chain 'B':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jb7b_
  • Chain 'C':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jb7c_
  • Heterogens: AMP, EPE, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jb7A (A:)
    msikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrh
    eandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkvi
    vaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb7A (A:)
    sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
    andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
    aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jb7B (B:)
    msikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrh
    eandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkvi
    vaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb7B (B:)
    sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
    andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
    aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jb7C (C:)
    msikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrh
    eandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkvi
    vaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb7C (C:)
    ikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhea
    ndeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviva
    eveperrgvvgvvdghsplgvetekdreerkkflrevvkykl