PDB entry 2jb6

View 2jb6 on RCSB PDB site
Description: fab fragment in complex with small molecule hapten, crystal form-2
Class: immune system
Keywords: cdr, tsc, fab, hucal, fluorescent dye, immunoglobulin domain, antibody fragment, diagnostic imaging, immune system
Deposited on 2006-12-03, released 2008-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment mor03268 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
    Domains in SCOPe 2.04: d2jb6a1, d2jb6a2
  • Chain 'B':
    Compound: fab fragment mor03268 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
    Domains in SCOPe 2.04: d2jb6b1, d2jb6b2
  • Chain 'H':
    Compound: fab fragment mor03268 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
    Domains in SCOPe 2.04: d2jb6h1, d2jb6h2
  • Chain 'L':
    Compound: fab fragment mor03268 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
    Domains in SCOPe 2.04: d2jb6l1, d2jb6l2
  • Heterogens: T5C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jb6A (A:)
    dialtqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgv
    snrfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6A (A:)
    altqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsn
    rfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jb6B (B:)
    qvqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksefeqkliseedlngaphh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6B (B:)
    qlvqsgaevkkpgssvkvsckasnyainwvrqapgqglewmgniepyfgtanyaqkfqgr
    vtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvssastkgps
    vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jb6H (H:)
    qvqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksefeqkliseedlngaphh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6H (H:)
    qlvqsgaevkkpgssvkvsckanyainwvrqapgqglewmgniepyfgtanyaqkfqgrv
    titadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2jb6L (L:)
    dialtqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgv
    snrfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6L (L:)
    ltqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsnr
    fsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt