PDB entry 2jb6

View 2jb6 on RCSB PDB site
Description: fab fragment in complex with small molecule hapten, crystal form-2
Class: immune system
Keywords: cdr, tsc, fab, hucal, fluorescent dye, immunoglobulin domain, antibody fragment, diagnostic imaging, immune system
Deposited on 2006-12-03, released 2008-01-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-11, with a file datestamp of 2008-03-07.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2312
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment mor03268 light chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
  • Chain 'B':
    Compound: fab fragment mor03268 heavy chain
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d2jb6b1, d2jb6b2
  • Chain 'H':
    Compound: fab fragment mor03268 heavy chain
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d2jb6h1, d2jb6h2
  • Chain 'L':
    Compound: fab fragment mor03268 light chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB6
  • Heterogens: T5C, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jb6B (B:)
    qvqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksefeqkliseedlngaphh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6B (B:)
    qlvqsgaevkkpgssvkvsckasnyainwvrqapgqglewmgniepyfgtanyaqkfqgr
    vtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvssastkgps
    vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jb6H (H:)
    qvqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksefeqkliseedlngaphh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb6H (H:)
    qlvqsgaevkkpgssvkvsckanyainwvrqapgqglewmgniepyfgtanyaqkfqgrv
    titadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    No sequence available.