PDB entry 2jb5

View 2jb5 on RCSB PDB site
Description: fab fragment in complex with small molecule hapten, crystal form-1
Class: immune system
Keywords: cdr, tsc, fab, hucal, fluorescent dye, immunoglobulin domain, antibody fragment, diagnostic imaging, immune system
Deposited on 2006-12-03, released 2008-01-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2112
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab fragment mor03268 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JB5 (Start-215)
    Domains in SCOPe 2.03: d2jb5h1, d2jb5h2
  • Chain 'L':
    Compound: fab fragment mor03268 light chain
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.03: d2jb5l1, d2jb5l2
  • Heterogens: T5C, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jb5H (H:)
    qvqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtany
    aqkfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksefeqkliseedlngaphh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb5H (H:)
    qlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtanyaq
    kfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvssas
    tkgpsvfplapssksgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2jb5L (L:)
    dialtqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgv
    snrfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jb5L (L:)
    altqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsn
    rfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt