PDB entry 2jaz
View 2jaz on RCSB PDB site
Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Class: hydrolase/inhibitor complex
Keywords: zinc, toxin, plasmid, nuclease, hydrolase, hydrolase/inhibitor complex, antibiotic, h-n-h motif, bacteriocin, endonuclease, metal-binding, antimicrobial, DNA hydrolysis, bacteriocin immunity, his metal finger motif
Deposited on
2006-12-01, released
2007-04-03
The last revision prior to the SCOP 1.73 freeze date was dated
2007-04-03, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.205
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: colicin e7 immunity protein
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2jaza1 - Chain 'B':
Compound: colicin e7
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Uniprot Q47112 (Start-130)
- engineered mutation (114)
- Chain 'C':
Compound: colicin e7 immunity protein
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2jazc1 - Chain 'D':
Compound: colicin e7
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Uniprot Q47112 (Start-130)
- engineered mutation (114)
- Heterogens: ZN, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2jazA (A:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg
Sequence, based on observed residues (ATOM records): (download)
>2jazA (A:)
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2jazC (C:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg
Sequence, based on observed residues (ATOM records): (download)
>2jazC (C:)
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg
- Chain 'D':
No sequence available.