PDB entry 2jaz

View 2jaz on RCSB PDB site
Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
Class: hydrolase/inhibitor complex
Keywords: zinc, toxin, plasmid, nuclease, hydrolase, hydrolase/inhibitor complex, antibiotic, h-n-h motif, bacteriocin, endonuclease, metal-binding, antimicrobial, DNA hydrolysis, bacteriocin immunity, his metal finger motif
Deposited on 2006-12-01, released 2007-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2jaza1
  • Chain 'B':
    Compound: colicin e7
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-130)
      • engineered mutation (114)
  • Chain 'C':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2jazc1
  • Chain 'D':
    Compound: colicin e7
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-130)
      • engineered mutation (114)
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jazA (A:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

    Sequence, based on observed residues (ATOM records): (download) 
    >2jazA (A:)
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2jazC (C:)
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

    Sequence, based on observed residues (ATOM records): (download) 
    >2jazC (C:)
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

  • Chain 'D':
    No sequence available.