PDB entry 2jat

View 2jat on RCSB PDB site
Description: structure of deoxyadenosine kinase from m.mycoides with products dcmp and a flexible dcdp bound
Class: transferase
Keywords: kinase, transferase, deoxyribonucleoside kinase
Deposited on 2006-11-30, released 2007-01-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jata_
  • Chain 'B':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jatb_
  • Heterogens: MG, POP, DCM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jatA (A:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
    nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
    vdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jatA (A:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvllsfdiviylr
    vstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvktqie
    limnklnsik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jatB (B:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
    nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
    vdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jatB (B:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvllsfdivi
    ylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvkt
    qielimnklnsi