PDB entry 2jam

View 2jam on RCSB PDB site
Description: Crystal structure of human calmodulin-dependent protein kinase I G
Class: transferase
Keywords: transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, protein serine/threonine kinase, calmodulin binding, calmodulin-binding, nucleotide binding, nucleotide-binding, lipoprotein, golgi apparatus, phosphorylation, allosteric enzyme
Deposited on 2006-11-29, released 2007-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium/calmodulin-dependent protein kinase type 1g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAM
    • Uniprot Q96NX5 (50-End)
    Domains in SCOPe 2.06: d2jama_
  • Chain 'B':
    Compound: calcium/calmodulin-dependent protein kinase type 1g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAM (Start-4)
    • Uniprot Q96NX5 (50-End)
    Domains in SCOPe 2.06: d2jamb_
  • Chain 'D':
    Compound: polypeptide
    Species: unidentified [TaxId:32644]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAM (0-5)
  • Chain 'E':
    Compound: polypeptide
    Species: unidentified [TaxId:32644]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAM (0-3)
  • Heterogens: EDO, J60, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jamA (A:)
    smqttnirktfifmevlgsgafsevflvkqrltgklfalkcikkspafrdssleneiavl
    kkikhenivtlediyestthyylvmqlvsggelfdrilergvytekdaslviqqvlsavk
    ylhengivhrdlkpenllyltpeenskimitdfglskmeqngimstacgtpgyvapevla
    qkpyskavdcwsigvityillcgyppfyeetesklfekikegyyefespfwddisesakd
    fichllekdpnerytcekalshpwidgntalhrdiypsvslqiqknfakskwrqafnaaa
    vvhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jamA (A:)
    nirktfifmevlgsgafsevflvkqrltgklfalkcikkssleneiavlkkikhenivtl
    ediyestthyylvmqlvsggelfdrilergvytekdaslviqqvlsavkylhengivhrd
    lkpenllyltpeenskimitdfglskmeqngimstacgtpgyvapevlaqkpyskavdcw
    sigvityillcgyppfyeetesklfekikegyyefespfwddisesakdfichllekdpn
    erytcekalshpwidgntalhrdiypsvslqiqknfaks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jamB (B:)
    smqttnirktfifmevlgsgafsevflvkqrltgklfalkcikkspafrdssleneiavl
    kkikhenivtlediyestthyylvmqlvsggelfdrilergvytekdaslviqqvlsavk
    ylhengivhrdlkpenllyltpeenskimitdfglskmeqngimstacgtpgyvapevla
    qkpyskavdcwsigvityillcgyppfyeetesklfekikegyyefespfwddisesakd
    fichllekdpnerytcekalshpwidgntalhrdiypsvslqiqknfakskwrqafnaaa
    vvhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jamB (B:)
    ttnirktfifmevlgsgafsevflvkqrltgklfalkcikkssleneiavlkkikheniv
    tlediyestthyylvmqlvsggelfdrilergvytekdaslviqqvlsavkylhengivh
    rdlkpenllyltpeenskimitdfglskmeqngimstacgtpgyvapevlaqkpyskavd
    cwsigvityillcgyppfyeetesklfekikegyyefespfwddisesakdfichllekd
    pnerytcekalshpwidgntalhrdiypsvslqiqknfak
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.