PDB entry 2jal

View 2jal on RCSB PDB site
Description: beta-glucosidase from thermotoga maritima in complex with cyclophellitol
Class: hydrolase
Keywords: polysaccharide degradation, glycosidase, glycoside hydrolase, cellulose degradation, carbohydrate metabolism, family 1, covalent, hydrolase, inhibitor
Deposited on 2006-11-29, released 2007-01-03
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2jala1
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAL
    • Uniprot Q08638 (23-End)
    Domains in SCOP 1.73: d2jalb1
  • Heterogens: ACT, CA, YLL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jalA (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jalA (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepaseravrfmhqfnn
    yplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfdpdak
    vsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrvhdq
    nridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkrivk
    dsgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jalB (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jalB (B:)
    nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
    kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
    wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
    pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
    mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
    fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs
    edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy
    stqkrivkdsgywysnvvknngle