PDB entry 2jai

View 2jai on RCSB PDB site
Description: ddah1 complexed with citrulline
Class: hydrolase
Keywords: ddah, hydrolase, nitric oxide synthase inhibitor
Deposited on 2006-11-29, released 2007-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ng, ng-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jaia_
  • Chain 'B':
    Compound: ng, ng-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JAI (0-4)
    • Uniprot O94760 (5-End)
    Domains in SCOPe 2.04: d2jaib_
  • Heterogens: CIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jaiA (A:)
    gplgmaglghpaafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgs
    klglqvvelpadeslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlni
    vemkdenatldggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlks
    fcsmagpnliaigssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllh
    rtpeeypesakvyeklkdhmlipvsmselekvdglltccsvlinkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaiA (A:)
    afgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpad
    eslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatldg
    gdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvglhlksfcsmagpnliaigs
    sesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesakvye
    klkdhmlipvsmselekvdglltccsvlink
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jaiB (B:)
    gplgmaglghpaafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgs
    klglqvvelpadeslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlni
    vemkdenatldggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlks
    fcsmagpnliaigssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllh
    rtpeeypesakvyeklkdhmlipvsmselekvdglltccsvlinkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaiB (B:)
    gplgmaglghpaafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgs
    klglqvvelpadeslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlni
    vemknatldggdvlftgffvglskrtnqrgaeiladtfkdyavstvpvlhlksfcsmagp
    nliaisesaqkalkimqqmrydkltvpddiaanciylnipnkghvllhrtpepesakvye
    klkdhmlipvsmselekvdglltccsvlink