PDB entry 2jaa

View 2jaa on RCSB PDB site
Description: semet substituted shigella flexneri ipad
Class: cell invasion
Keywords: ipad, t3ss, semet, plasmid, invasin, virulence, cell invasion, shigella flexneri, type III secretion
Deposited on 2006-11-24, released 2006-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2628
AEROSPACI score: -1.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invasin ipad
    Species: Shigella flexneri [TaxId:623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jaaa1
  • Chain 'B':
    Compound: invasin ipad
    Species: Shigella flexneri [TaxId:623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jaab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jaaA (A:)
    aeldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwisp
    ggndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqk
    nggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqk
    ysnansifdnlvkvlsstissctdtdklflhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaaA (A:)
    mishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwvnslkkalee
    lkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksln
    akyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jaaB (B:)
    aeldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwisp
    ggndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqk
    nggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqk
    ysnansifdnlvkvlsstissctdtdklflhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaaB (B:)
    ldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispvk
    lqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsin
    mtpidnmlksldnlnakyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsst
    is