PDB entry 2ja9

View 2ja9 on RCSB PDB site
Description: structure of the n-terminal deletion of yeast exosome component rrp40
Class: RNA-binding protein
Keywords: RNA-binding protein, RNA, exosome, nuclease, s1 domain, kh domain, hydrolase, RNA-binding, exonuclease, nuclear protein, rRNA processing, nucleic-acid binding
Deposited on 2006-11-24, released 2006-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: exosome complex exonuclease rrp40
  Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08285 (0-174)
    • conflict (98)
  Domains in SCOPe 2.08: d2ja9a1, d2ja9a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ja9A (A:)
  kryipsvndfvigviigtfsdsykvslqnfsssvslsymafpnaskknrptlqvgdlvya
  rvctaekeleaeiecfdsttgrdagfgiledgmiidvnlnfarqllfnndfpllkvlaah
  tkfevaiglngkiwvkceelsntlacyrtimeccqkndtaafkdiakrqfkeilt