PDB entry 2j9v

View 2j9v on RCSB PDB site
Description: 2 angstrom x-ray structure of the yeast escrt-I vps28 c-terminus
Class: protein transport
Keywords: nzf finger, hiv budding, protein transport, vps, mvb, chmp, escrt, vps36, vps28, transport
Deposited on 2006-11-16, released 2007-01-23
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vacuolar protein sorting-associated protein 28
  Species: SACCHAROMYCES CEREVISIAE
  Database cross-references and differences (RAF-indexed):
  • PDB 2J9V (0-3)
  • Uniprot Q02767 (4-98)
  Domains in SCOP 1.75: d2j9va1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j9vA (A:)
  hhhmfnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrskli
  dwivrinklsigdtltetqirellfdlelayksfyalld