PDB entry 2j9u

View 2j9u on RCSB PDB site
Description: 2 angstrom x-ray structure of the yeast escrt-I vps28 c-terminus in complex with the nzf-n domain from escrt-II
Class: protein transport
Keywords: zinc-finger, metal-binding, protein transport
Deposited on 2006-11-16, released 2007-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vacuolar protein sorting-associated protein 28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j9ua_
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein 36
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j9ub1
  • Chain 'C':
    Compound: vacuolar protein sorting-associated protein 28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j9uc_
  • Chain 'D':
    Compound: vacuolar protein sorting-associated protein 36
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j9ud_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9uA (A:)
    mfnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwi
    vrinklsigdtltetqirellfdlelayksfyalld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9uA (A:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9uB (B:)
    mahhhhhhmasadvvstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssin
    csnaidpnanprnqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9uB (B:)
    vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j9uC (C:)
    mfnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwi
    vrinklsigdtltetqirellfdlelayksfyalld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9uC (C:)
    fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
    rinklsigdtltetqirellfdlelayksfyall
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j9uD (D:)
    mahhhhhhmasadvvstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssin
    csnaidpnanprnqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9uD (D:)
    vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc