PDB entry 2j9t

View 2j9t on RCSB PDB site
Description: BipD of Burkholderia Pseudomallei
Class: toxin
Keywords: burkholderia pseudomallei, bipd, ttss, t3ss, type 3 secretion system, toxin
Deposited on 2006-11-16, released 2006-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.213
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane antigen
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:28450]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9ta1
  • Chain 'B':
    Compound: membrane antigen
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:28450]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9tb_
  • Heterogens: BO3, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9tA (A:)
    gsaltvrdwpalealaktmpadagaramtdddlraagvdrrvpeqklgaaidefaslrlp
    dridgrfvdgrranltvfddarvavrgharaqrnllerletellggtldtagdeggiqpd
    pilqglvdvigqgksdidayativegltkyfqsvadvmsklqdyisakddknmkidggki
    kaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvtinpdklikmrdslppdgt
    vwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnlvkvlsgaistltdtaksy
    lqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9tA (A:)
    mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
    haraqrnllerletelldpilqglvdvigqgksdidayativegltkyfqsvadvmsklq
    dyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvt
    inpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnl
    vkvlsgaistlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9tB (B:)
    gsaltvrdwpalealaktmpadagaramtdddlraagvdrrvpeqklgaaidefaslrlp
    dridgrfvdgrranltvfddarvavrgharaqrnllerletellggtldtagdeggiqpd
    pilqglvdvigqgksdidayativegltkyfqsvadvmsklqdyisakddknmkidggki
    kaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvtinpdklikmrdslppdgt
    vwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnlvkvlsgaistltdtaksy
    lqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9tB (B:)
    mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
    haraqrnllerletelldpilqglvdvigqgksdidayativegltkyfqsvadvmsklq
    dyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvt
    inpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnl
    vkvlsgaistlt