PDB entry 2j9r

View 2j9r on RCSB PDB site
Description: thymidine kinase from b. anthracis in complex with dt.
Class: transferase
Keywords: tk1, dnk, lasso, kinase, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate acceptor, nucleotide-binding
Deposited on 2006-11-15, released 2007-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: BACILLUS ANTHRACIS [TaxId:260799]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9R (Start-19)
    • Uniprot Q81JX0 (20-End)
    Domains in SCOPe 2.06: d2j9ra1, d2j9ra2, d2j9ra3
  • Heterogens: ZN, THM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9rA (A:)
    mgsshhhhhhssglvprgshmylinqngwievicgsmfsgkseelirrvrrtqfakqhai
    vfkpcidnryseedvvshnglkvkavpvsaskdifkhiteemdviaidevqffdgdivev
    vqvlanrgyrvivagldqdfrglpfgqvpqlmaiaehvtklqavcsacgspasrtqrlid
    gepaafddpiilvgasesyeprcrhchavptkqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9rA (A:)
    shmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcvkavpvsaskdif
    khiteemdviaidevqffdgdivevvqvlanrgyrvivagldqdfrglpfgqvpqlmaia
    ehvtklqavcsacgspasrtqrlidgepaafddpiilvgasesyeprcrhchavptkq