PDB entry 2j9q

View 2j9q on RCSB PDB site
Description: a novel conformation for the tpr domain of pex5p
Class: protein transport
Keywords: transport, zellweger syndrome, protein transport
Deposited on 2006-11-15, released 2007-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (3-327)
      • expression tag (0-2)
      • conflict (113)
    Domains in SCOPe 2.06: d2j9qa2, d2j9qa3
  • Chain 'B':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (Start-327)
      • conflict (113)
    Domains in SCOPe 2.06: d2j9qb_
  • Heterogens: SR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9qA (A:)
    gmgltsatydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmea
    wqylgttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlr
    ytpayahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvq
    cglgvlfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralel
    qpgyirsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlal
    smlgqsdaygaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9qA (A:)
    gmgltsatydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmea
    wqylgttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlr
    ytpayahlvtpslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaa
    lsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahre
    avehflealnmqrksrggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9qB (B:)
    gmgltsatydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmea
    wqylgttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlr
    ytpayahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvq
    cglgvlfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralel
    qpgyirsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlal
    smlgqsdaygaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9qB (B:)
    navllfeaavqqdpkhmeawqylgttqaeneqellaisalrrclelkpdnqtalmalavs
    ftneslqrqaceilrdwlrytpayahlvtpsllsdslflevkelflaavrldptsidpdv
    qcglgvlfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrrale
    lqpgyirsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrla
    lsmlgqsdaygaadardlstlltmfglpq