PDB entry 2j9n

View 2j9n on RCSB PDB site
Description: Robotically harvested Trypsin complexed with Benzamidine containing polypeptide mediated crystal contacts
Class: hydrolase
Keywords: robotic harvest, intermolecular contacts, trypsin, calcium, zymogen, protease, digestion, salmon protamine peptides, hydrolase, benzamidine, metal-binding, serine protease
Deposited on 2006-11-14, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9na_
  • Chain 'B':
    Compound: Unknown peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9N (0-14)
  • Chain 'C':
    Compound: Unknown peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9N (0-2)
  • Heterogens: CA, NA, BEN, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j9nA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.