PDB entry 2j9j
View 2j9j on RCSB PDB site
Description: Atomic-resolution Crystal Structure of Chemically-Synthesized HIV-1 Protease Complexed with Inhibitor JG-365
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, protease, hydrolase, high resolution, RNA-directed DNA polymerase, aspartyl protease, human immunodeficiency virus 1, hydrolase- hydrolase inhibitor complex
Deposited on
2006-11-11, released
2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-05-22, with a file datestamp of
2019-05-17.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot O38907 (0-98)
- conflict (6)
- conflict (35)
- conflict (40)
- conflict (45)
- conflict (61)
- conflict (63)
- conflict (92)
Domains in SCOPe 2.08: d2j9ja_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot O38907 (0-98)
- conflict (6)
- conflict (17)
- conflict (35)
- conflict (40)
- conflict (45)
- conflict (61)
- conflict (63)
- conflict (92)
Domains in SCOPe 2.08: d2j9jb_ - Chain 'C':
Compound: inhibitor molecule jg365
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, GOL, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2j9jA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2j9jB (B:)
pqitlwkrplvtiriggnlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'C':
No sequence available.