PDB entry 2j9h

View 2j9h on RCSB PDB site
Description: Crystal structure of human glutathione-S-transferase P1-1 cys-free mutant in complex with S-hexylglutathione at 2.4 A resolution
Class: transferase
Keywords: p1-1, transferase, glutathione, glutathione transferase
Deposited on 2006-11-08, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered mutation (13)
      • engineered mutation (46)
      • engineered mutation (100)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d2j9ha1, d2j9ha2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered mutation (13)
      • engineered mutation (46)
      • engineered mutation (100)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d2j9hb1, d2j9hb2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j9hA (A:)
    ppytvvyfpvrgrsaalrmlladqgqswkeevvtvetwqegslkasalygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrakyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgsldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j9hB (B:)
    ppytvvyfpvrgrsaalrmlladqgqswkeevvtvetwqegslkasalygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrakyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgsldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq