PDB entry 2j9c

View 2j9c on RCSB PDB site
Description: structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake
Class: membrane transport
Keywords: em single particle, nitrogen metabolism, signalling, transcription, membrane transport, hypothetical protein, transcription regulation
Deposited on 2006-11-07, released 2007-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.145
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical nitrogen regulatory pii-like protein mj0059
    Species: METHANOCOCCUS JANNASCHII [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9C (114-End)
    • Uniprot Q60381 (2-113)
    Domains in SCOPe 2.06: d2j9ca1, d2j9ca2
  • Chain 'B':
    Compound: hypothetical nitrogen regulatory pii-like protein mj0059
    Species: METHANOCOCCUS JANNASCHII [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9C (114-End)
    • Uniprot Q60381 (2-113)
    Domains in SCOPe 2.06: d2j9cb1, d2j9cb2
  • Chain 'C':
    Compound: hypothetical nitrogen regulatory pii-like protein mj0059
    Species: METHANOCOCCUS JANNASCHII [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J9C (114-End)
    • Uniprot Q60381 (2-113)
    Domains in SCOPe 2.06: d2j9cc1, d2j9cc2
  • Heterogens: ATP, MG, CL, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9cA (A:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeallehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9cA (A:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkealleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9cB (B:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeallehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9cB (B:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkealleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j9cC (C:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeallehhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9cC (C:)
    gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
    vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkealleh