PDB entry 2j98

View 2j98 on RCSB PDB site
Description: human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)
Class: RNA-binding protein
Keywords: ssb, hcov, membrane, helicase, sars cov, viral replicase, RNA replication, ATP-binding, nucleotide-binding, ribosomal frameshift, RNA-binding protein
Deposited on 2006-11-03, released 2007-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1ab
    Species: HUMAN CORONAVIRUS 229E [TaxId:11137]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U2
      • engineered mutation (68)
    Domains in SCOPe 2.05: d2j98a_
  • Chain 'B':
    Compound: Replicase polyprotein 1ab
    Species: HUMAN CORONAVIRUS 229E [TaxId:11137]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U2
      • conflict (4)
      • engineered mutation (68)
    Domains in SCOPe 2.05: d2j98b_
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j98A (A:)
    nneimpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgv
    vtvelepparfvidtptgpqikylyfvknlnnlrrgavlgyigatvrlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j98A (A:)
    eimpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgvvt
    velepparfvidtptgpqikylyfvknlnnlrrgavlgyigatvrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j98B (B:)
    nneikpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgv
    vtvelepparfvidtptgpqikylyfvknlnnlrrgavlgyigatvrlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j98B (B:)
    kpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgvvtve
    lepparfvidtptgpqikylyfvknlnnlrrgavlgyigatv