PDB entry 2j90

View 2j90 on RCSB PDB site
Description: crystal structure of human zip kinase in complex with a tetracyclic pyridone inhibitor (pyridone 6)
Class: transferase
Keywords: nuclear protein, nucleotide-binding, serine/threonine- protein kinase, chromatin regulator, myosin phosphorylation, kinase, muscle, apoptosis, transferase, ATP-binding
Deposited on 2006-10-31, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J90 (Start-22)
    • Uniprot O43293 (23-End)
    Domains in SCOPe 2.07: d2j90a1, d2j90a2
  • Chain 'B':
    Compound: death-associated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j90b_
  • Heterogens: IZA, CL, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j90A (A:)
    mhhhhhhssgvdlgtenlyfqsmvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfik
    krrlsssrrgvsreeierevnilreirhpniitlhdifenktdvvlilelvsggelfdfl
    aekesltedeatqflkqildgvhylhskriahfdlkpenimlldknvpnpriklidfgia
    hkieagnefknifgtpefvapeivnyeplgleadmwsigvityillsgaspflgetkqet
    ltnisavnydfdeeyfsntselakdfirrllvkdpkrrmtiaqslehswikairrrnvrg
    edsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j90A (A:)
    fqsmvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreeiere
    vnilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflkqil
    dgvhylhskriahfdlkpenimlldknvpnpriklidfgiahkiegtpefvapeivnyep
    lgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfir
    rllvkdpkrrmtiaqslehswikai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j90B (B:)
    mhhhhhhssgvdlgtenlyfqsmvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfik
    krrlsssrrgvsreeierevnilreirhpniitlhdifenktdvvlilelvsggelfdfl
    aekesltedeatqflkqildgvhylhskriahfdlkpenimlldknvpnpriklidfgia
    hkieagnefknifgtpefvapeivnyeplgleadmwsigvityillsgaspflgetkqet
    ltnisavnydfdeeyfsntselakdfirrllvkdpkrrmtiaqslehswikairrrnvrg
    edsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j90B (B:)
    hyemgeelgsgqfaivrkcrqkeyaakfikkrrlsssrrgvsreeierevnilreirhpn
    iitlhdifenktdvvlilelvsggelfdflaeksltedeatqflkqildgvhylhskria
    hfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtpefvapeivnyeplgl
    eadmwsigvityillsgaspflgetkqetltnisavnydfdeeyfsntselakdfirrll
    vkdpkrrmtiaqslehswikairr