PDB entry 2j8n

View 2j8n on RCSB PDB site
Description: structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature
Class: transferase
Keywords: gcn5 family, phosphinothricin, methionine sulfone, pseudomonas aeruginosa, methionine sulfoximine, n-acetyl transferase, hypothetical protein, transferase
Deposited on 2006-10-26, released 2007-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.1888
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase pa4866 from p. aeruginosa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • conflict (46)
    Domains in SCOPe 2.06: d2j8na_
  • Chain 'B':
    Compound: acetyltransferase pa4866 from p. aeruginosa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • conflict (46)
    Domains in SCOPe 2.06: d2j8nb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j8nA (A:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8nA (A:)
    sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaag
    evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai
    esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j8nB (B:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8nB (B:)
    asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
    gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
    iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap