PDB entry 2j8m

View 2j8m on RCSB PDB site
Description: Structure of P. aeruginosa acetyltransferase PA4866
Class: transferase
Keywords: gcn5 family, phosphinothricin, methionine sulfone, transferase methionine sulfoximine, n-acetyl transferase, hypothetical protein, transferase
Deposited on 2006-10-26, released 2007-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.1994
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase pa4866 from p. aeruginosa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • conflict (46)
    Domains in SCOPe 2.06: d2j8ma_
  • Chain 'B':
    Compound: acetyltransferase pa4866 from p. aeruginosa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUU7 (Start-171)
      • conflict (46)
    Domains in SCOPe 2.06: d2j8mb_
  • Heterogens: AZI, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j8mA (A:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8mA (A:)
    sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasda
    agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva
    aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j8mB (B:)
    msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasd
    aagevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmv
    aaiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8mB (B:)
    asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
    gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
    iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap