PDB entry 2j8i

View 2j8i on RCSB PDB site
Description: structure of np275, a pentapeptide repeat protein from nostoc punctiforme
Class: toxin
Keywords: toxin
Deposited on 2006-10-25, released 2006-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: np275
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J8I (Start-117)
    Domains in SCOPe 2.08: d2j8ia1, d2j8ia2
  • Chain 'B':
    Compound: np275
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J8I (Start-117)
    Domains in SCOPe 2.08: d2j8ib2, d2j8ib3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j8iA (A:)
    mgsshhhhhhssglvprgshmdveklrqlyaagerdfsivdlrgavleninlsgailhga
    mldeanlqqanlsradlsgatlngadlrganlskadlsdaildnailegaildeavln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8iA (A:)
    glvprgshmdveklrqlyaagerdfsivdlrgavleninlsgailhgamldeanlqqanl
    sradlsgatlngadlrganlskadlsdaildnailegaildeavln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j8iB (B:)
    mgsshhhhhhssglvprgshmdveklrqlyaagerdfsivdlrgavleninlsgailhga
    mldeanlqqanlsradlsgatlngadlrganlskadlsdaildnailegaildeavln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8iB (B:)
    sshhhhhhssglvprgshmdveklrqlyaagerdfsivdlrgavleninlsgailhgaml
    deanlqqanlsradlsgatlngadlrganlskadlsdaildnailegaildeavln