PDB entry 2j8h

View 2j8h on RCSB PDB site
Description: structure of the immunoglobulin tandem repeat a168-a169 of titin
Class: transferase
Keywords: cardiomyopathy, nuclear protein, serine/threonine-protein kinase, limb-girdle muscular dystrophy, phosphorylation, disease mutation, structural protein, titin, a-band, kinase, wd repeat, tpr repeat, immunoglobulin domain, immunoglobulin like domain, nucleotide-binding, ATP-binding, transferase, kelch repeat
Deposited on 2006-10-25, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J8H (Start-2)
    • Uniprot Q8WZ42 (3-196)
    Domains in SCOPe 2.07: d2j8ha1, d2j8ha2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j8hA (A:)
    gamaphfkeelrnlnvryqsnatlvckvtghpkpivkwyrqgkeiiadglkyriqefkgg
    yhqliiasvtdddatvyqvratnqggsvsgtaslevevpakihlpktlegmgavhalrge
    vvsikipfsgkpdpvitwqkgqdlidnnghyqvivtrsftslvfpngverkdagfyvvca
    knrfgidqktveldvad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8hA (A:)
    maphfkeelrnlnvryqsnatlvckvtghpkpivkwyrqgkeiiadglkyriqefkggyh
    qliiasvtdddatvyqvratnqggsvsgtaslevevpakihlpktlegmgavhalrgevv
    sikipfsgkpdpvitwqkgqdlidnnghyqvivtrsftslvfpngverkdagfyvvcakn
    rfgidqktveldvad