PDB entry 2j8e
View 2j8e on RCSB PDB site
Description: chey-phob emr chimera to study dephosphorylation of response regulators
Class: transferase
Keywords: transferase, bef3, magnesium, chemotaxis, acetylation, flagellar rotation, sensory transduction, metal-binding, activated chey, receiver domain, two-component signal transduction, two-component regulatory system, transferase phosphorylation, signaling protein, response regulator
Deposited on
2006-10-24, released
2007-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-09-29, with a file datestamp of
2009-09-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered mutation (12)
- engineered mutation (57)
- engineered mutation (87)
Domains in SCOPe 2.08: d2j8ea_ - Chain 'B':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered mutation (12)
- engineered mutation (57)
- engineered mutation (87)
Domains in SCOPe 2.08: d2j8eb_ - Heterogens: BEF, MN, GOL, NH4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2j8eA (A:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2j8eB (B:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm