PDB entry 2j8b

View 2j8b on RCSB PDB site
Description: high resolution structure of human cd59
Class: lipid-binding protein
Keywords: lipid-binding protein, glycoprotein, lipid-binding protein mac, membrane, gpi-anchor, complement, lipoprotein
Deposited on 2006-10-24, released 2007-08-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.165
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd59 glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J8B (0-0)
    • Uniprot P13987 (1-End)
    Domains in SCOPe 2.01: d2j8ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2j8bA (A:)
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqleng

    Sequence, based on observed residues (ATOM records): (download) 
    >2j8bA (A:)
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlen