PDB entry 2j88

View 2j88 on RCSB PDB site
Description: Hyaluronidase in complex with a monoclonal IgG Fab fragment
Class: hydrolase
Keywords: glycoprotein, glycosidase family 56, zymogen, allergen, 7- stranded (beta/alpha) tim barrel, hydrolase, glycosidase, immunoglobulin domain
Deposited on 2006-10-23, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyalurononglucosaminidase
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j88a_
  • Chain 'H':
    Compound: fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J88
    Domains in SCOPe 2.06: d2j88h1
  • Chain 'L':
    Compound: fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J88 (0-End)
    Domains in SCOPe 2.06: d2j88l1, d2j88l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j88A (A:)
    tpdnnktvrefnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmf
    pallkdpngnvvarnggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifr
    qnwaslqpykklsvevvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaan
    wgyyaypycynltpnqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervgl
    vggrvkealriarqmttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfii
    wgssddintkakclqfreylnnelgpavkrialnnnandrltvdvsvdqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j88A (A:)
    efnvywnvptfmchkyglrfeevsekygilqnwmdkfrgeeiailydpgmfpallkvvar
    nggvpqlgnltkhlqvfrdhlinqipdksfpgvgvidfeswrpifrqnwaslqpykklsv
    evvrrehpfwddqrveqeakrrfekygqlfmeetlkaakrmrpaanwgyyaypycynltp
    nqpsaqceattmqendkmswlfesedvllpsvylrwnltsgervglvggrvkealriarq
    mttsrkkvlpyywykyqdrrdtdlsradleatlrkitdlgadgfiiwgssddintkakcl
    qfreylnnelgpavkrial
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j88H (H:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvswirqpsgkglewlahiywdddkr
    ynpslksrltiskdtsrnqvflkitsvdtadtatyyctlyygsvdywgqgtsvtvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j88H (H:)
    vtlkesgpgilqpsqtlsltcsfsgfslstsgmgvswirqpsgkglewlahiywdddkry
    npslksrltiskdtsrnqvflkitsvdtadtatyyctlyygsvdywgqgtsvtvssaktt
    ppsvygclvkgyfpepvtvtwnsghtfpavlqsdlytlsssv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j88L (L:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkisslqpedfgnyycqhhygtrtfgggtrleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j88L (L:)
    diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkisslqpedfgnyycqhhygtrtfgggtrleikradaaptvsifvvc
    flnnfypkdinvkwkgvlnswtdqddstysmsstltltkdeytceathktstspi