PDB entry 2j80

View 2j80 on RCSB PDB site
Description: structure of citrate-bound periplasmic domain of sensor histidine kinase cita
Class: transferase
Keywords: signal transduction, sensor histidine kinase, cita, kinase, membrane, transferase, sensor domain, transmembrane, inner membrane, phosphorylation, two-component regulatory system
Deposited on 2006-10-18, released 2007-10-23
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-23, with a file datestamp of 2007-10-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1942
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j80a1
  • Chain 'B':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j80b1
  • Heterogens: FLC, NA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j80A (A:)
    ghmditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyit
    vgdasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgk
    vigivsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j80A (A:)
    teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
    gqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigiv
    svgytieql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j80B (B:)
    ghmditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyit
    vgdasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgk
    vigivsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j80B (B:)
    erlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasgq
    rlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivsv
    gyti