PDB entry 2j80

View 2j80 on RCSB PDB site
Description: Structure of Citrate-bound Periplasmic Domain of Sensor Histidine Kinase CitA
Class: transferase
Keywords: transferase, signal transduction, transmembrane, phosphorylation, two-component regulatory system
Deposited on 2006-10-18, released 2007-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j80a_
  • Chain 'B':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j80b_
  • Heterogens: FLC, NA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j80A (A:)
    ghmditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyit
    vgdasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgk
    vigivsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j80A (A:)
    teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
    gqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigiv
    svgytieql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j80B (B:)
    ghmditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyit
    vgdasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgk
    vigivsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j80B (B:)
    erlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasgq
    rlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivsv
    gyti