PDB entry 2j7z

View 2j7z on RCSB PDB site
Description: crystal structure of recombinant human stromal cell-derived factor-1alpha
Class: growth factor
Keywords: growth factor, alternative splicing, cxcr4, cytokine, refolding, chemotaxis, sdf-1alpha
Deposited on 2006-10-18, released 2006-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2133
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stromal cell-derived factor 1 alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48061 (0-67)
  Domains in SCOPe 2.08: d2j7za_
• Chain 'B':
  Compound: stromal cell-derived factor 1 alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48061 (0-67)
  Domains in SCOPe 2.08: d2j7zb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j7zA (A:)
  kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
  ylekalnk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j7zB (B:)
  kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
  ylekalnk