PDB entry 2j7t

View 2j7t on RCSB PDB site
Description: crystal structure of human serine threonine kinase-10 bound to su11274
Class: transferase
Keywords: kinase, transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding, lymphocyte oriented kinase (lok), serine/threonine- protein kinase, serine/threonine kinase (stk10a)
Deposited on 2006-10-17, released 2006-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J7T
    • Uniprot O94804 (Start-301)
    Domains in SCOPe 2.06: d2j7ta_
  • Heterogens: CA, ACT, 274, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j7tA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j7tA (A:)
    hvrrdldpnevweivgelgdgafgkvykaknketgalaaakvieeeledyiveieilatc
    dhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnfl
    hskriihrdlkagnvlmtlegdirladfgvsaknlktlqkigtpywmapevvmcetmkdt
    pydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflk
    ialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee