PDB entry 2j7j

View 2j7j on RCSB PDB site
Description: Invariance of the zinc finger module: a comparison of the free structure with those in nucleic-acid complexes
Class: transcription
Keywords: zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, RNA-binding, zinc-finger, DNA-binding, transcription regulation, transcription, metal-binding
Deposited on 2006-10-10, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.218
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor iiia
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J7J (0-0)
    • Uniprot P03001 (1-84)
    Domains in SCOPe 2.07: d2j7ja1, d2j7ja2, d2j7ja3
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j7jA (A:)
    myvchfencgkafkkhnqlkvhqfshtqqlpyecphegcdkrfslpsrlkrhekvhagyp
    ckkddscsfvgktwtlylkhvaech