PDB entry 2j75

View 2j75 on RCSB PDB site
Description: beta-glucosidase from thermotoga maritima in complex with noeuromycin
Class: hydrolase
Keywords: family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism, glycoside hydrolase, cellulose degradation
Deposited on 2006-10-06, released 2006-12-11
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j75a1
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j75b1
  • Heterogens: ACT, CA, NOY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j75A (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j75A (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasediravrfmhqf
    nnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfdap
    akvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrvh
    dqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkri
    vkdsgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j75B (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j75B (B:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
    hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
    dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
    dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
    tqkrivkdsgywysnvvknngl