PDB entry 2j74

View 2j74 on RCSB PDB site
Description: Structure of Beta-1,4-Galactanase
Class: hydrolase
Keywords: glycoside hydrolase family 53, hydrolase, gh-a, beta-1, galactan, 4-galactanase
Deposited on 2006-10-06, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yvfo
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j74a_
  • Chain 'B':
    Compound: yvfo
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j74b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j74A (A:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j74A (A:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j74B (B:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j74B (B:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpfk