PDB entry 2j71

View 2j71 on RCSB PDB site
Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Class: hydrolase
Keywords: hydrolase, alpha-glucan binding, carbohydrate-binding module, glycosidase, beta-sandwich fold
Deposited on 2006-10-05, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pullulanase
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O33840 (Start-102)
    • conflict (1)
  Domains in SCOPe 2.08: d2j71a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2j71A (A:)
  ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
  giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2j71A (A:)
  tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
  iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp