PDB entry 2j70

View 2j70 on RCSB PDB site
Description: structural and functional characterisation of partner-switching regulating the environmental stress response in b. subtilis
Class: hydrolase
Keywords: environmental stress response, partner switching, protein phosphatase, rsbt, rsbu, hydrolase, bacillus subtilis
Deposited on 2006-10-05, released 2007-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphoserine phosphatase rsbu
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40399 (0-End)
    • engineered mutation (77)
  Domains in SCOPe 2.04: d2j70a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2j70A (A:)
  mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
  slpedvfhsldflievmkgygmayqehqtlrgiqqeikseieiaanvqqtl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2j70A (A:)
  mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
  slpedvfhsldflievmkgygma