PDB entry 2j70

View 2j70 on RCSB PDB site
Description: Structural and functional characterisation of partner-switching regulating the environmental stress response in B. subtilis
Class: hydrolase
Keywords: environmental stress response, partner switching, protein phosphatase, rsbt, rsbu, hydrolase, bacillus subtilis
Deposited on 2006-10-05, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399 (0-End)
      • engineered mutation (77)
    Domains in SCOPe 2.08: d2j70a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j70A (A:)
    mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmkgygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j70A (A:)
    mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmkgygma