PDB entry 2j6y

View 2j6y on RCSB PDB site
Description: structural and functional characterisation of partner switching regulating the environmental stress response in bacillus subtilis
Class: hydrolase
Keywords: hydrolase, partner switching, protein phosphatase, rsbt, rsbu, stress, bacillus subtilis
Deposited on 2006-10-05, released 2007-02-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399 (0-End)
      • engineered mutation (23)
    Domains in SCOPe 2.03: d2j6ya_
  • Chain 'B':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399
      • engineered mutation (23)
    Domains in SCOPe 2.03: d2j6yb_
  • Chain 'C':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399
      • engineered mutation (23)
    Domains in SCOPe 2.03: d2j6yc_
  • Chain 'D':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399
      • engineered mutation (23)
    Domains in SCOPe 2.03: d2j6yd_
  • Chain 'E':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40399
      • engineered mutation (23)
    Domains in SCOPe 2.03: d2j6ye_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6yA (A:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6yA (A:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j6yB (B:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6yB (B:)
    evieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelypslpe
    dvfhsldflievmigygmayq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j6yC (C:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6yC (C:)
    frevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelypsl
    pedvfhsldflievmigygmayqeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j6yD (D:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6yD (D:)
    dfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyps
    lpedvfhsldflievmigygmayq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j6yE (E:)
    mdfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmayqehqtlrgiqqeikseieiaanvqqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6yE (E:)
    dfrevieqryhqllsryiaeltktslyqaqkfsrktiehqippeeiisihrkvlkelyps
    lpedvfhsldflievmigygm