PDB entry 2j6x

View 2j6x on RCSB PDB site
Description: the crystal structure of lactate oxidase
Class: oxidoreductase
Keywords: biosensors, flavoenzyme, fmn-dependent, oxidoreductase
Deposited on 2006-10-05, released 2006-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xa_
  • Chain 'B':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xb_
  • Chain 'C':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xc_
  • Chain 'D':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xd_
  • Chain 'E':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xe_
  • Chain 'F':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xf_
  • Chain 'G':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xg_
  • Chain 'H':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • conflict (231)
      • conflict (254)
    Domains in SCOPe 2.01: d2j6xh_
  • Heterogens: FMN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6xA (A:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xA (A:)
    dieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhklly
    prlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisay
    sgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrd
    vknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiq
    hpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgeh
    vakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgld
    lfdnpygyey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j6xB (B:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xB (B:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j6xC (C:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xC (C:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhp
    edadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
    kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
    dnpygyey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j6xD (D:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xD (D:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivniygaskqkisprdieeiaahsglpvfvkgiqhpedadmaikagasgiw
    vsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrp
    vlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j6xE (E:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xE (E:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j6xF (F:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xF (F:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqslnniygaskqkisprdieeiaahsglpvfvkgiqhpedadmaikaga
    sgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvva
    lgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j6xG (G:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xG (G:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j6xH (H:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6xH (H:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpiskqkisprdieeiaahsglpvfvkgiqhpedadmaikagasgiwvsnhg
    arqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrpvlfgl
    alggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey