PDB entry 2j6t

View 2j6t on RCSB PDB site
Description: ternary complex of sulfolobus solfataricus dpo4 DNA polymerase, o6-methylguanine modified DNA, and datp.
Class: transferase/DNA
Keywords: transferase-DNA complex, mutator protein, DNA replication, o6-methylguanine, transferase, metal-binding, translesion DNA synthesis, DNA-directed DNA polymerase, dpo4, DNA repair, DNA damage, DNA-binding, nucleotidyltransferase
Deposited on 2006-10-04, released 2006-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6T
    • Uniprot Q97W02 (6-End)
    Domains in SCOPe 2.07: d2j6ta1, d2j6ta2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*c)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*tp*xp*gp*ap*ap*tp*cp *cp*tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: DTP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6tA (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6tA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.