PDB entry 2j6k

View 2j6k on RCSB PDB site
Description: n-terminal sh3 domain of cms (cd2ap human homolog)
Class: protein binding
Keywords: phosphorylation, adaptor protein, egfr downregulation, sh3, sh3 domain, sh3-binding, cd2 associated protein, cytoskeletal rearrangements, surface active protein, signaling protein, protein binding
Deposited on 2006-09-29, released 2006-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6ka_
  • Chain 'B':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kb_
  • Chain 'C':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kc_
  • Chain 'D':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kd_
  • Chain 'E':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6ke_
  • Chain 'F':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kf_
  • Chain 'G':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kg_
  • Chain 'H':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kh_
  • Chain 'I':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6ki_
  • Chain 'J':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kj_
  • Chain 'K':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kk_
  • Chain 'L':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j6kl_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6kA (A:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kA (A:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j6kB (B:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kB (B:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j6kC (C:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kC (C:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j6kD (D:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kD (D:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j6kE (E:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kE (E:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j6kF (F:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kF (F:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j6kG (G:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kG (G:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j6kH (H:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kH (H:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j6kI (I:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kI (I:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j6kJ (J:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kJ (J:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2j6kK (K:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kK (K:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j6kL (L:)
    mvdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeikre
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6kL (L:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik