PDB entry 2j6e

View 2j6e on RCSB PDB site
Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
Class: immune system
Keywords: autoimmune complex human igm rheumatoid factor igg1-fc, immunoglobulin c region, membrane, glycoprotein, transmembrane, hypothetical protein, immune system, immunoglobulin domain
Deposited on 2006-09-28, released 2007-04-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2234
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (54)
    Domains in SCOPe 2.03: d2j6ea1, d2j6ea2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (54)
    Domains in SCOPe 2.03: d2j6eb1, d2j6eb2
  • Chain 'H':
    Compound: igm
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6E (Start-227)
    Domains in SCOPe 2.03: d2j6eh1, d2j6eh2
  • Chain 'I':
    Compound: igm
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6E (Start-227)
    Domains in SCOPe 2.03: d2j6ei1, d2j6ei2
  • Chain 'L':
    Compound: igm
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.03: d2j6el1, d2j6el2
  • Chain 'M':
    Compound: igm
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.03: d2j6em1, d2j6em2
  • Heterogens: CD, ZN, CAC, MPD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6eA (A:)
    epkscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j6eB (B:)
    epkscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslspg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j6eH (H:)
    lllvaaprwlsqlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglew
    igsiyysgntyfnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldg
    mdvwgqgttvtvssgsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdis
    strgfpsvlrggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eH (H:)
    qlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglewigsiyysgnty
    fnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldgmdvwgqgttvt
    vssgsasaptlfplvssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
    atsqvllpskdvmqgtdehvvckvqhpngnkeknvp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j6eI (I:)
    lllvaaprwlsqlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglew
    igsiyysgntyfnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldg
    mdvwgqgttvtvssgsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdis
    strgfpsvlrggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eI (I:)
    qlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglewigsiyysgnty
    fnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldgmdvwgqgttvt
    vssgsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrg
    gkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j6eL (L:)
    magfpllltllthcagswaqsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlp
    gtapklliyrnnqrpsgvpdrfsgsksgtsaslaisglrsedeadyycatwddslsavif
    gggtkltvlgqpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvka
    gvettkpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eL (L:)
    qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
    drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2j6eM (M:)
    magfpllltllthcagswaqsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlp
    gtapklliyrnnqrpsgvpdrfsgsksgtsaslaisglrsedeadyycatwddslsavif
    gggtkltvlgqpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvka
    gvettkpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eM (M:)
    qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
    drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec