PDB entry 2j6c

View 2j6c on RCSB PDB site
Description: crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses
Class: viral protein
Keywords: virus, acidianus, sulfolobus, crenarchaea, viral protein
Deposited on 2006-09-27, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.186
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afv3-109
    Species: ACIDIANUS FILAMENTOUS VIRUS 1 [TaxId:235266]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6C (0-108)
    Domains in SCOPe 2.08: d2j6ca_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j6cA (A:)
    mlyilnsailplkpgeeytvkakeitiqeakelvtkeqftsaighqataellssilgvnv
    pmnrvqikvthgdrilafmlkqrlpegvvvktteelekigyelwlfeiq