PDB entry 2j67

View 2j67 on RCSB PDB site
Description: the tir domain of human toll-like receptor 10 (tlr10)
Class: receptor
Keywords: tir, il-1, toll, tlr10, membrane, receptor, inflammatory response, toll-like receptor 10, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane
Deposited on 2006-09-26, released 2006-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toll like receptor 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J67
    • Uniprot Q9BXR5 (Start-177)
    Domains in SCOPe 2.07: d2j67a_
  • Chain 'B':
    Compound: toll like receptor 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J67
    • Uniprot Q9BXR5 (Start-177)
    Domains in SCOPe 2.07: d2j67b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j67A (A:)
    mhhhhhhssgvdlgtenlyfqsmkttqeqlkrnvrfhafisysehdslwvknelipnlek
    edgsiliclyesyfdpgksisenivsfieksyksifvlspnfvqnewchyefyfahhnlf
    hensdhiilillepipfyciptryhklkallekkaylewpkdrrkcglfwanlraain
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j67A (A:)
    lkrnvrfhafisysehdslwvknelipnlekedsiliclyesyfdpgksisenivsfiek
    syksifvlspnfvqnewchyefyfahhnhiilillepipfyciptryhklkallekkayl
    ewpkdrrkcglfwanlraain
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j67B (B:)
    mhhhhhhssgvdlgtenlyfqsmkttqeqlkrnvrfhafisysehdslwvknelipnlek
    edgsiliclyesyfdpgksisenivsfieksyksifvlspnfvqnewchyefyfahhnlf
    hensdhiilillepipfyciptryhklkallekkaylewpkdrrkcglfwanlraain
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j67B (B:)
    rnvrfhafisysehdslwvknelipnlekedgsiliclyesyfdpgksisenivsfieks
    yksifvlspnfvqnewchyefyfahhnlfhensdhiilillepipfyekkaylewpkdrr
    kcglfwanlraain