PDB entry 2j65

View 2j65 on RCSB PDB site
Description: structure of lpxc from aquifex aeolicus in complex with udp
Class: hydrolase
Keywords: hydrolase, lipid synthesis, lipid a biosynthesis
Deposited on 2006-09-26, released 2006-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered mutation (180)
    Domains in SCOPe 2.06: d2j65a1, d2j65a2
  • Chain 'B':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered mutation (180)
    Domains in SCOPe 2.06: d2j65b1, d2j65b2
  • Heterogens: ZN, CL, MYR, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j65A (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j65A (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j65B (B:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j65B (B:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk