PDB entry 2j62

View 2j62 on RCSB PDB site
Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
Class: hydrolase
Keywords: hydrolase
Deposited on 2006-09-22, released 2007-02-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase
    Species: CLOSTRIDIUM PERFRINGENS, synthetic [TaxId:1502]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • conflict (357)
    Domains in SCOPe 2.01: d2j62a1, d2j62a2, d2j62a3
  • Chain 'B':
    Compound: hyaluronidase
    Species: CLOSTRIDIUM PERFRINGENS, synthetic [TaxId:1502]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • conflict (357)
    Domains in SCOPe 2.01: d2j62b1, d2j62b2, d2j62b3
  • Heterogens: CL, GSZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j62A (A:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j62A (A:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j62B (B:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j62B (B:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli