PDB entry 2j5x

View 2j5x on RCSB PDB site
Description: structure of the small g protein arf6 in complex with gtpgammas
Class: protein transport
Keywords: membrane traffic, protein transport, ras, arf, arf6, g protein, myristate, transport, er-golgi transport, nucleotide-binding, lipoprotein, GTP-binding, golgi apparatus
Deposited on 2006-09-20, released 2006-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j5xa_
  • Chain 'B':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j5xb_
  • Heterogens: GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5xA (A:)
    mgkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfn
    vwdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilif
    ankqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5xA (A:)
    nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5xB (B:)
    mgkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfn
    vwdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilif
    ankqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5xB (B:)
    nkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdki
    rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
    kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk