PDB entry 2j5w

View 2j5w on RCSB PDB site
Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites
Class: oxidoreductase
Keywords: oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase, ceruloplasmin, metal-binding, ion transport
Deposited on 2006-09-19, released 2007-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ceruloplasmin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00450
      • conflict (254)
      • conflict (270)
    Domains in SCOPe 2.03: d2j5wa1, d2j5wa2, d2j5wa3, d2j5wa4, d2j5wa5
  • Heterogens: CA, NA, CU, O, OXY, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5wA (A:)
    mkililgiflflcstpawakekhyyigiiettwdyasdhgekklisvdtehsniylqngp
    drigrlykkalylqytdetfrttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfh
    shgityykehegaiypdnttdfqraddkvypgeqytymllateeqspgegdgncvtriyh
    shidapkdiasgligpliickkdsldkekekhidrefvvmfsvvdenfswyledniktyc
    sepekvdkdnedfqqsnrmysvngytfgslsglsmcaedrvkwylfgmgnevdvhaaffh
    gqaltnknyridtinlfpatlfdaymvaqnpgewmlscqnlnhlkaglqaffqvqecnks
    sskdnirgkhvrhyyiaaeeiiwnyapsgidiftkenltapgsdsavffeqgttriggsy
    kklvyreytdasftnrkergpeeehlgilgpviwaevgdtirvtfhnkgayplsiepigv
    rfnknnegtyyspnynpqsrsvppsashvaptetftyewtvpkevgptnadpvclakmyy
    savdptkdiftgligpmkickkgslhangrqkdvdkefylfptvfdeneslllednirmf
    ttapdqvdkededfqesnkmhsmngfmygnqpgltmckgdsvvwylfsagneadvhgiyf
    sgntylwrgerrdtanlfpqtsltlhmwpdtegtfnveclttdhytggmkqkytvnqcrr
    qsedstfylgertyyiaavevewdyspqrewekelhhlqeqnvsnafldkgefyigskyk
    kvvyrqytdstfrvpverkaeeehlgilgpqlhadvgdkvkiifknmatrpysihahgvq
    tesstvtptlpgetltyvwkipersgagtedsacipwayystvdqvkdlysgligplivc
    rrpylkvfnprrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmha
    ingrmfgnlqgltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifp
    gtyqtlemfprtpgiwllhchvtdhihagmettytvlqnedtksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5wA (A:)
    kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
    frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
    tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
    ckkdsldkekekhidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqqsnrm
    ysvngytfgslsglsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpa
    tlfdaymvaqnpgewmlscqnlnhlkaglqaffqvqecnkssskdnirgkhvrhyyiaae
    eiiwnyapsgidiftkenltapgsdsavffeqgttriggsykklvyreytdasftnrker
    gpeeehlgilgpviwaevgdtirvtfhnkgayplsiepigvrfnknnegtyyspnvppsa
    shvaptetftyewtvpkevgptnadpvclakmyysavdptkdiftgligpmkickkgslh
    angrqkdvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngf
    mygnqpgltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlh
    mwpdtegtfnveclttdhytggmkqkytvnqcrrqsedstfylgertyyiaavevewdys
    pqrewekelhhlqeqnvsnafldkgefyigskykkvvyrqytdstfrvpverkaeeehlg
    ilgpqlhadvgdkvkiifknmatrpysihahgvqtesstvtptlpgetltyvwkipersg
    agtedsacipwayystvdqvkdlysgligplivcrrpnprrklefallflvfdeneswyl
    ddniktysdhpekvnkddeefiesnkmhaingrmfgnlqgltmhvgdevnwylmgmgnei
    dlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfprtpgiwllhchvtdhihagme
    ttytvlqne